PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 356aa    MW: 39358.6 Da    PI: 4.365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004043genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +l++ +  +G  +W+++++  g+ R++k+c++rw +yl
      Lus10004043 14 KGPWTADEDRKLINFILTHGQCCWRAVPKLSGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.92.1e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d+++qlG++ W++Ia+ m+ gRt++++k++w+++
      Lus10004043  70 LSESEEKLVIDLHAQLGNR-WSKIASQMP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-20563IPR009057Homeodomain-like
PROSITE profilePS5129414.216961IPR017930Myb domain
SuperFamilySSF466897.11E-2711108IPR009057Homeodomain-like
SMARTSM007176.6E-131363IPR001005SANT/Myb domain
PfamPF002499.3E-141461IPR001005SANT/Myb domain
CDDcd001671.66E-91661No hitNo description
PROSITE profilePS5129426.53362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2464116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002494.4E-1570111IPR001005SANT/Myb domain
CDDcd001675.49E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAD EDRKLINFIL THGQCCWRAV PKLSGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEKLVID LHAQLGNRWS KIASQMPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPCTHQPLL PTTTTDTTTQ EQQEQHSSSK DISTNEPDPL VLNTVSPESA TEATSSLTSS  180
ISSSSSSTIV DDDLQSAITQ LANQLDVPDY RNAMEEVLNY GDIGFGLEEV PLVEFEPHEI  240
ITNDCSKNNN IDIDVEFSPP ANLSSSSSSC INDHTNDSAN GNGGNDYNVL GAEDDCWWAS  300
QLTTKEGQLM GLWADDDLGC WDLAVNDEIN CEIQMMAASL GSCLDANDDY FSWAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPGSC0003DMT4000404624e-92(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-83myb domain protein 20